PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00493.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 338aa    MW: 38118.8 Da    PI: 6.6058
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00493.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.21.1e-191461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEde+lv++v+++G  +W++ ++  g++R++k+c++rw +yl
  Rsa1.0_00493.1_g00007.1 14 KGPWTPEEDEKLVNYVQKHGHSSWRALPKLAGLNRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding55.71.1e-1767112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+++++E++ ++++++ lG++ W+tIa++++ gRt++++k++w+++l
  Rsa1.0_00493.1_g00007.1  67 RGKFSPDEEQTILNLHAVLGNK-WSTIANHLP-GRTDNEIKNFWNTHL 112
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-25664IPR009057Homeodomain-like
PROSITE profilePS5129418.953961IPR017930Myb domain
SuperFamilySSF466892.46E-3211108IPR009057Homeodomain-like
SMARTSM007179.1E-161363IPR001005SANT/Myb domain
PfamPF002493.7E-181461IPR001005SANT/Myb domain
CDDcd001678.62E-131661No hitNo description
PROSITE profilePS5129426.94762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-2865117IPR009057Homeodomain-like
SMARTSM007174.3E-1666114IPR001005SANT/Myb domain
PfamPF002493.8E-1667112IPR001005SANT/Myb domain
CDDcd001673.24E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGRSPSSDDS GLKKGPWTPE EDEKLVNYVQ KHGHSSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SPDEEQTILN LHAVLGNKWS TIANHLPGRT DNEIKNFWNT HLKKKLIQMG  120
IDPMTHRPRT DIFSSLSQLM SLSSNLRGFV DMQQQFPSGQ DQTILKLQTE MAKLQLFQYL  180
LQSPSMNSNI NNPNDFDILS LLNTIASFKD TTTSNSLDLG SYLQDFNSLP SLKTLNSNME  240
PSSIFPQTPE DNHFKFFNQR ENLPVSPIWL SDPTNSTQSM LPSFAPSSAV SDDMIRNQYV  300
IEHVNSNLTS SSQESGASAS ATWPDHLLDD SIFSDIIP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00503DAPTransfer from AT5G10280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756600.0KM975660.1 Brassica napus MYB transcription factor 92.1 (MYB92.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009125309.10.0PREDICTED: transcription factor MYB39-like
RefseqXP_009125310.10.0PREDICTED: transcription factor MYB39-like
RefseqXP_009125311.10.0PREDICTED: transcription factor MYB39-like
RefseqXP_009125312.10.0PREDICTED: transcription factor MYB39-like
RefseqXP_009125313.10.0PREDICTED: transcription factor MYB39-like
RefseqXP_009125314.10.0PREDICTED: transcription factor MYB39-like
RefseqXP_009125315.10.0PREDICTED: transcription factor MYB39-like
RefseqXP_009125316.10.0PREDICTED: transcription factor MYB39-like
RefseqXP_009125317.10.0PREDICTED: transcription factor MYB39-like
RefseqXP_013712379.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP01e-74MYB39_ARATH; Transcription factor MYB39
TrEMBLM4EIH80.0M4EIH8_BRARP; Uncharacterized protein
STRINGBra028593.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.11e-178myb domain protein 92